£€0€ €0€ €0€ €p¡€0€ €1ABO¡€remark 3: Refinement.¡€-remark 3: Program 1 X-Plor¡€.remark 3: Authors 1 Brunger¡€*remark 3: Program 2 Arp¡€4remark 3: Authors 2 Lamzin,Wilson¡€,remark 3: R Value 0.156¡€7remark 3: Rmsd Bond Distances 0.008 Angstroms¡€5remark 3: Rmsd Bond Angles 1.51 Degrees¡€+remark 3: Number Of Reflections 7499¡€7remark 3: Resolution Range 8.0 - 2.0 Angstroms¡€6remark 3: Data Cutoff 1. Sigma(F)¡€remark 3: Data Collection.¡€6remark 3: Completeness Of Data 89. %¡€/remark 3: Number Of Atoms Used In Refinement.¡€>remark 3: Number Of Protein Atoms 1050¡€>remark 3: Number Of Nucleic Acid Atoms 0¡€>remark 3: Number Of Heterogen Atoms 10¡€>remark 3: Number Of Solvent Atoms 122¡€!remark 18: Experimental Details.¡€6remark 18: Date Of Data Collection : 20-Dec-93¡€-remark 18: Monochromatic (YN) : Y¡€-remark 18: Laue (YN) : N¡€1remark 18: Wavelength Or Range (A) : 1.54¡€8remark 18: Detector Type : Image Plate¡€8remark 18: Detector Manufacturer : Marresearch¡€0remark 18: Intensity-Integration Software : Xds¡€2remark 18: Merging R Value (Intensity) : 0.029¡€0remark 999: Cross Reference To Sequence Database¡€¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€/¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€ 0€ €0€ €¡€'¢€¡€0€ €¡€(¢€0€ €0€ €¡€(¢€¡€0€ €¡€)¢€0€ €0€ €¡€)¢€¡€0€ €¡€*¢€ 0€ €0€ €¡€*¢€¡€0€ €¡€+¢€0€ €0€ €¡€+¢€¡€0€ €¡€,¢€0€ €0€ €¡€,¢€¡€0€ €¡€-¢€ 0€ €0€ €¡€-¢€¡€0€ €¡€.¢€ 0€ €0€ €¡€.¢€¡€0€ €¡€/¢€0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€0€ €0€ €¡€1¢€¡€0€ €¡€2¢€0€ €0€ €¡€2¢€¡€0€ €¡€3¢€0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€0€ €0€ €¡€8¢€¡€0€ €¡€9¢€ 0€ €0€ €¡€9¢€¡€0€ €¡€:¢€ 0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €¡€0€ €B£€SEQRES¨€¥€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€†Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD¢€«€³£€0€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€'0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ € ¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ € ¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ € ¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €!¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €"¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €#¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €&¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €(¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €)¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €*¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €+¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €,¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €-¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €.¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €/¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €0¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €1¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €2¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €3¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €4¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €5¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €6¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €7¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €8¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €9¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €;¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €<¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €=¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€/¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€ 0€ €0€ €¡€'¢€¡€0€ €¡€(¢€0€ €0€ €¡€(¢€¡€0€ €¡€)¢€0€ €0€ €¡€)¢€¡€0€ €¡€*¢€ 0€ €0€ €¡€*¢€¡€0€ €¡€+¢€0€ €0€ €¡€+¢€¡€0€ €¡€,¢€0€ €0€ €¡€,¢€¡€0€ €¡€-¢€ 0€ €0€ €¡€-¢€¡€0€ €¡€.¢€ 0€ €0€ €¡€.¢€¡€0€ €¡€/¢€0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€0€ €0€ €¡€1¢€¡€0€ €¡€2¢€0€ €0€ €¡€2¢€¡€0€ €¡€3¢€0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€0€ €0€ €¡€8¢€¡€0€ €¡€9¢€ 0€ €0€ €¡€9¢€¡€0€ €¡€:¢€ 0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €¡€0€ €C£€SEQRES¨€¥€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€†Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD¢€«€´£€0€0€ €¡€ 1 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€,¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €¡€0€ €D£€SEQRES¨€¥€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€†Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD¢€«€µ£€0€0€ €¡€ 1 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€,¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €¡€0€ €1¨€£€0€0€ €¡€ 410 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 411 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 1 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 2 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 3 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 4 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 5 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 6 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 7 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 8 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 9 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 10 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 11 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 12 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 13 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 14 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 15 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 16 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 17 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 18 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 19 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 20 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 21 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 22 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 23 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 24 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 25 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 26 ¢€ €0€ €!¡€0€ €1¨€£€0€0€ €¡€ 27 ¢€ €0€ €"¡€0€ €1¨€£€0€0€ €¡€ 28 ¢€ €0€ €#¡€0€ €1¨€£€0€0€ €¡€ 29 ¢€ €0€ €$¡€0€ €1¨€£€0€0€ €¡€ 30 ¢€ €0€ €%¡€0€ €1¨€£€0€0€ €¡€ 31 ¢€ €0€ €&¡€0€ €1¨€£€0€0€ €¡€ 32 ¢€ €0€ €'¡€0€ €1¨€£€0€0€ €¡€ 33 ¢€ €0€ €(¡€0€ €1¨€£€0€0€ €¡€ 34 ¢€ €0€ €)¡€0€ €1¨€£€0€0€ €¡€ 35 ¢€ €0€ €*¡€0€ €1¨€£€0€0€ €¡€ 36 ¢€ €0€ €+¡€0€ €1¨€£€0€0€ €¡€ 37 ¢€ €0€ €,¡€0€ €1¨€£€0€0€ €¡€ 38 ¢€ €0€ €-¡€0€ €1¨€£€0€0€ €¡€ 39 ¢€ €0€ €.¡€0€ €1¨€£€0€0€ €¡€ 40 ¢€ €0€ €/¡€0€ €1¨€£€0€0€ €¡€ 41 ¢€ €0€ €0¡€0€ €1¨€£€0€0€ €¡€ 42 ¢€ €0€ €1¡€0€ €1¨€£€0€0€ €¡€ 43 ¢€ €0€ €2¡€0€ €1¨€£€0€0€ €¡€ 44 ¢€ €0€ €3¡€0€ €1¨€£€0€0€ €¡€ 45 ¢€ €0€ €4¡€0€ €1¨€£€0€0€ €¡€ 46 ¢€ €0€ €5¡€0€ €1¨€£€0€0€ €¡€ 47 ¢€ €0€ €6¡€0€ €1¨€£€0€0€ €¡€ 48 ¢€ €0€ €7¡€0€ €1¨€£€0€0€ €¡€ 49 ¢€ €0€ €8¡€0€ €1¨€£€0€0€ €¡€ 50 ¢€ €0€ €9¡€0€ €1¨€£€0€0€ €¡€ 51 ¢€ €0€ €:¡€0€ €1¨€£€0€0€ €¡€ 52 ¢€ €0€ €;¡€0€ €1¨€£€0€0€ €¡€ 53 ¢€ €0€ €<¡€0€ €1¨€£€0€0€ €¡€ 54 ¢€ €0€ €=¡€0€ €1¨€£€0€0€ €¡€ 55 ¢€ €0€ €>¡€0€ €1¨€£€0€0€ €¡€ 56 ¢€ €0€ €?¡€0€ €1¨€£€0€0€ €¡€ 57 ¢€ €0€ €@¡€0€ €1¨€£€0€0€ €¡€ 58 ¢€ €0€ €A¡€0€ €1¨€£€0€0€ €¡€ 59 ¢€ €0€ €B¡€0€ €1¨€£€0€0€ €¡€ 60 ¢€ €0€ €C¡€0€ €1¨€£€0€0€ €¡€ 61 ¢€ €0€ €D¡€0€ €1¨€£€0€0€ €¡€ 62 ¢€ €0€ €E¡€0€ €1¨€£€0€0€ €¡€ 63 ¢€ €0€ €F¡€0€ €1¨€£€0€0€ €¡€ 64 ¢€ €0€ €G¡€0€ €1¨€£€0€0€ €¡€ 65 ¢€ €0€ €H¡€0€ €1¨€£€0€0€ €¡€ 66 ¢€ €0€ €I¡€0€ €1¨€£€0€0€ €¡€ 67 ¢€ €0€ €J¡€0€ €1¨€£€0€0€ €¡€ 68 ¢€ €0€ €K¡€0€ €1¨€£€0€0€ €¡€ 69 ¢€ €0€ €L¡€0€ €1¨€£€0€0€ €¡€ 70 ¢€ €0€ €M¡€0€ €1¨€£€0€0€ €¡€ 71 ¢€ €0€ €N¡€0€ €1¨€£€0€0€ €¡€ 73 ¢€ €0€ €O¡€0€ €1¨€£€0€0€ €¡€ 74 ¢€ €0€ €P¡€0€ €1¨€£€0€0€ €¡€ 75 ¢€ €0€ €Q¡€0€ €1¨€£€0€0€ €¡€ 76 ¢€ €0€ €R¡€0€ €1¨€£€0€0€ €¡€ 77 ¢€ €0€ €S¡€0€ €1¨€£€0€0€ €¡€ 78 ¢€ €0€ €T¡€0€ €1¨€£€0€0€ €¡€ 79 ¢€ €0€ €U¡€0€ €1¨€£€0€0€ €¡€ 80 ¢€ €0€ €V¡€0€ €1¨€£€0€0€ €¡€ 81 ¢€ €0€ €W¡€0€ €1¨€£€0€0€ €¡€ 82 ¢€ €0€ €X¡€0€ €1¨€£€0€0€ €¡€ 83 ¢€ €0€ €Y¡€0€ €1¨€£€0€0€ €¡€ 84 ¢€ €0€ €Z¡€0€ €1¨€£€0€0€ €¡€ 85 ¢€ €0€ €[¡€0€ €1¨€£€0€0€ €¡€ 86 ¢€ €0€ €\¡€0€ €1¨€£€0€0€ €¡€ 87 ¢€ €0€ €]¡€0€ €1¨€£€0€0€ €¡€ 88 ¢€ €0€ €^¡€0€ €1¨€£€0€0€ €¡€ 89 ¢€ €0€ €_¡€0€ €1¨€£€0€0€ €¡€ 90 ¢€ €0€ €`¡€0€ €1¨€£€0€0€ €¡€ 91 ¢€ €0€ €a¡€0€ €1¨€£€0€0€ €¡€ 92 ¢€ €0€ €b¡€0€ €1¨€£€0€0€ €¡€ 93 ¢€ €0€ €c¡€0€ €1¨€£€0€0€ €¡€ 94 ¢€ €0€ €d¡€0€ €1¨€£€0€0€ €¡€ 95 ¢€ €0€ €e¡€0€ €1¨€£€0€0€ €¡€ 96 ¢€ €0€ €f¡€0€ €1¨€£€0€0€ €¡€ 97 ¢€ €0€ €g¡€0€ €1¨€£€0€0€ €¡€ 98 ¢€ €0€ €h¡€0€ €1¨€£€0€0€ €¡€ 99 ¢€ €0€ €i¡€0€ €1¨€£€0€0€ €¡€ 100 ¢€ €0€ €j¡€0€ €1¨€£€0€0€ €¡€ 101 ¢€ €0€ €k¡€0€ €1¨€£€0€0€ €¡€ 102 ¢€ €0€ €l¡€0€ €1¨€£€0€0€ €¡€ 103 ¢€ €0€ €m¡€0€ €1¨€£€0€0€ €¡€ 104 ¢€ €0€ €n¡€0€ €1¨€£€0€0€ €¡€ 105 ¢€ €0€ €o¡€0€ €1¨€£€0€0€ €¡€ 106 ¢€ €0€ €p¡€0€ €1¨€£€0€0€ €¡€ 107 ¢€ €0€ €q¡€0€ €1¨€£€0€0€ €¡€ 108 ¢€ €0€ €r¡€0€ €1¨€£€0€0€ €¡€ 109 ¢€ €0€ €s¡€0€ €1¨€£€0€0€ €¡€ 110 ¢€ €0€ €t¡€0€ €1¨€£€0€0€ €¡€ 111 ¢€ €0€ €u¡€0€ €1¨€£€0€0€ €¡€ 112 ¢€ €0€ €v¡€0€ €1¨€£€0€0€ €¡€ 113 ¢€ €0€ €w¡€0€ €1¨€£€0€0€ €¡€ 114 ¢€ €0€ €x¡€0€ €1¨€£€0€0€ €¡€ 115 ¢€ €0€ €y¡€0€ €1¨€£€0€0€ €¡€ 116 ¢€ €0€ €z¡€0€ €1¨€£€0€0€ €¡€ 117 ¢€ €0€ €{¡€0€ €1¨€£€0€0€ €¡€ 118 ¢€ €0€ €|¡€0€ €1¨€£€0€0€ €¡€ 119 ¢€ €0€ €}¡€0€ €1¨€£€0€0€ €¡€ 120 ¢€ €0€ €~¡€0€ €1¨€£€0€0€ €¡€ 121 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 122 ¢€ €£€0€0€ €¡€0€ €SO4£€ Sulfate Ion¢€ÿ£€0€X¤€0€0€ €¡€ S ¢€0€ S £€ 0€ €¡€ O1 ¢€0€ O1 £€ 0€ €¡€ O2 ¢€0€ O2 £€ 0€ €¡€ O3 ¢€0€ O3 £€ 0€ €¡€ O4 ¢€0€ O4 £€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€0€ €HOH£€¢€ÿ£€0€X¤€0€0€ €¡€ O ¢€0€ O £€ ¥€0€£€0€0€ €¡€0€ €PDB secondary structure¢€0€0€ €¡€ 1¢€¤€ €¡€¡€0€0€ €¡€6¢€80€ €¡€ 2¢€¤€ €¡€¡€0€0€ €¡€6¢€80€ €¡€ A 1¢€¤€ €¡€¡€0€0€ €¡€9¢€;0€ €¡€ A 2¢€¤€ €¡€¡€0€0€ €¡€¢€ 0€ €¡€ A 3¢€¤€ €¡€¡€0€0€ €¡€¢€"0€ €¡€ A 4¢€¤€ €¡€¡€0€0€ €¡€(¢€-0€ €¡€ A 5¢€¤€ €¡€¡€0€0€ €¡€0¢€50€ €¡€ B 1¢€¤€ €¡€¡€0€0€ €¡€9¢€;0€ € ¡€ B 2¢€¤€ €¡€¡€0€0€ €¡€¢€ 0€ € ¡€ B 3¢€¤€ €¡€¡€0€0€ €¡€¢€"0€ € ¡€ B 4¢€¤€ €¡€¡€0€0€ €¡€(¢€-0€ € ¡€ B 5¢€¤€ €¡€¡€0€0€ €¡€0¢€50€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€strand 1¢€¤€ €¡€¡€0€0€ €¡€¢€ 0€ €¡€strand 2¢€¤€ €¡€¡€0€0€ €¡€ ¢€0€ €¡€strand 3¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€strand 4¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€strand 5¢€¤€ €¡€¡€0€0€ €¡€ ¢€#0€ €¡€strand 6¢€¤€ €¡€¡€0€0€ €¡€(¢€.0€ €¡€strand 7¢€¤€ €¡€¡€0€0€ €¡€/¢€50€ €¡€strand 8¢€¤€ €¡€¡€0€0€ €¡€8¢€<0€ € ¡€strand 9¢€¤€ €¡€¡€0€0€ €¡€¢€ 0€ € ¡€ strand 10¢€¤€ €¡€¡€0€0€ €¡€ ¢€0€ € ¡€ strand 11¢€¤€ €¡€¡€0€0€ €¡€¢€0€ € ¡€ strand 12¢€¤€ €¡€¡€0€0€ €¡€¢€0€ € ¡€ strand 13¢€¤€ €¡€¡€0€0€ €¡€ ¢€#0€ €¡€ strand 14¢€¤€ €¡€¡€0€0€ €¡€(¢€.0€ €¡€ strand 15¢€¤€ €¡€¡€0€0€ €¡€/¢€50€ €¡€ strand 16¢€¤€ €¡€¡€0€0€ €¡€8¢€<¤€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry 1ABO with a vector model attached¡€ Resolution: 2¢€X-Ray Diffraction£€OCT 15 95 Initial Entry£€0€ € ¡€ ¤€0€0€ €¢€ € €0€ €¡€0€ €¡€0€      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~¢€0€                                                    !!!!""""""""""""########$$$$$$$$$$%%%%%%%%&&&&'''''''''(((((((((((((())))))*********+++++,,,,,,,,,-------.........////////0000111111111222233333333333333444444455555556666667777777788888888888899999999:::::::;;;;;;;<<<<<<<========>>>>>>>                                                    !!!!""""""""""""########$$$$$$$$$$%%%%%%%%&&&&'''''''''(((((((((((((())))))*********+++++,,,,,,,,,-------.........////////0000111111111222233333333333333444444455555556666667777777788888888888899999999:::::::;;;;;;;<<<<<<<========>>>>>>>                              £€0€                                                                                                                                                                                                                                        ¢€0€ €è¡€0€=78§"£$H#(':õ ä  ‡¼: 4 Gϼ¤çVm4Iª)×Z;útùö&þéÿ"úóöXþ}üùö¢ò6ûãý€§ø£ù£÷ÇùËýOùàúvö@ÿEö×èû«üE÷šù.þcÿ@õAð2ï¼ìœÉϨ ”–¶Ÿ¿° < _.‘[ÇkªÛwH 9&1(Økê(C-Û0º.O5â9/7„7ã9u;­>t:²54/È/º8ß7Í:f4!,'È#l#`%Í%)ÀãªLŽid¢„ V U b [ Œ´žÿDþ¶`m k îûVöô«ö2ñåóüí7ñÔð,í¥ê„ì3êÐåËæé„ïìãðïDóÅ÷û4ýÏùÆýþÙþö6ûÄ‚éký¹øÜô¿öŒò§ðA)?Õ m ŽYlß V!a!Ö!‚Óø ¿%*-+!$â)î E-j2o6û;3n//d/"6`:’9P5=B=LiO-LM’T RÜQrR¸PtQ1HE?r<E[CD@ß>t964Å0?5ð1Ý/±+53÷4õ7‡8Œ8–2ö1p1–5*4ÿ47#/Ê5"0¢+f-:( (ù-Ã-@-*e("&A0G0@,!,—5“5’:¹]èYÔZØ\ì`øcÖ^*U.PÅMXKþMqOåK”M‚MÒLJOÇKùHBóAÌJcFOG?…9ù6\2X7ü:ÿ8¦:â7¥4]6d:k3›50–,6Â;èá@‡>\D—@ÐD£H2H%K¯KžCúCŽCF)H“It?I>¿BAO98^2µ/1ßEÝI”IfG`OKàLQ¾T HmEwAq<ÁC;T YaYYUE]A[Ý]G]ê^C\ºZ®cÏefjÝlÑm]Ÿ\cV¤Tõ_±eyh­fÙSžN(KÁMãGwDŸC)AÚ?¿<7?7¡2¶CtB0CÜEÏCLD—J7L§@ì;b878M3\3K9G/?5D0NL:QŠQM0U˜UÎTeTãTŽU]XëYZˆY§RRhW©Y`N#I#Z/_9cðh^_È_Ë_•`bôg*hKk¡e¼gŸf{johl jÒlaewf)f‰e-až\xaWÃhOhÝg°h‹nhn^ryeyd>häm`ªb¸c¡h?lLjFfnrpzmvlZhocÖjwkðnjhjTg'j×jXdaUnLJ¶E¦E%IER@[?TBqC=9|7p;tD<G$CZDàKhI8Oò>l:’8!8,6s3Æ.€+±6e4 .~,436‡,~'<##ô'5*{/©œ4á± þ‰ø Ä ìïªY… š›<„ Úþ™úÁ÷ü÷kö÷÷ºý…öŠ',M- *,K2³4g21T:Y;‡7<0ä.™2Ö1´*ö-¦&7¶<.?O? ?©@ÕEÇGÃBEIíK“F~FÝB/LP¾UU‘Q/OJpY©^C`â`a»`ZZqcüfÃk<léi#eÌhÊ`¹lõqMvv’qíl„j£y‘~A‚5¹€|~ãyP…ÃIâL(DíM>I{&4$I&m+>"Ò%^Ò*#þÄ2:%óAšJf8ÿ>ðrì©îð 7ã}  ÅÜÆQEXXpX‹Z>Ú0"4•4%jmnÀXXdj]Ff@ìý~ä«I͈ØNc"á Nüûô¬/ý_ ík*hã¤ý|-·EOHÉSX>âtB>(úœ0…R Lw5÷‹ ðB™mÄ‚14#Ð]Îç%Ë&CTK'M8K¾fÿP[þ O ›x%#³($ñ¬&äSë6]!ÐóÞ *RâqzCU ®–ÃY¡T (ŠLÏ+íEN¨-FˆŽ Ø#.7°׸áÐë3¢€0€Ú¹à„áµâÖâ|ç…è=êíáâçé.Þ"ÞÇÜðÛÁêkïÅðcìãóŸô ïëøðEøïôÉôÑõùû¥þñõ ùõ0ü³ù‡*Ç $vTŽe‚ ÞŒí剞ï`!ú_!®#ª Íœá¬þH ©õñ,7L\ji<¶OG³ê¿û\:<"#§$§|ÿNRãF!w°¢"Ê ƒ^„HFþpûâüJ  ‹Ð=x„qÏ4ýÚùpö÷õaš­ þP š ÒWÞÿäêâ!ÿCú´“ÝšMÿe î `iÚ›þñùêõ5ðÕö'ò ð8ófóñïÒñyö6íÿëè·èˆèã/ã ßLÙ¯ÕóèÕè¨æ°æúî ò¯ôb÷#äVâVæAçÐÜÐÚõÕÒ†ÍùË`Ì è'ëåèãågï{ò«ó3ê/ç‘ê©èlæ‹ã˜äYÝ×ïÍóøËúUûü§\ÑXQüµKúêý¿ü! t `a dÕ4NúT6Øhâ' g"6$FýÃýâ!°#†'÷ *@èŽÈ¢q;!Ò%Ù*Ñ+:.Tý™ ö MTS§` Rh‹ «ÊÎ þ“5Žý„ýù‹õbòb÷ ô<ñËî6ómõ#ñ£íÖî”ôëé¿åÏå>ä£à€Ü ÖÕ¿Ò²å®åàóÞ¬ê7ë0îÚß÷ÜÞ#ÛÚ©×]Ö ÒvÔÖãE徿-ç%ë*êõë#ê‹å¢æç­æùé×ë¬ñòCè$âÛß·árÛ(ô9ùvüµúë-5 âúQ[[?ÍlMïgÈ ·ø ƆèQ­MZ\¯ÞG’Щéš4Ñ—!0#t •(››þu `A›7#÷ $$~)W øª= „ª¹ýˆ>tüŒùoNÎfúëõdò•ôêõˆúÁþBíŒêCå÷ãçªäTë¸åîâ6äœçÝôÙrÙ=ÕËãUå&â´åë&í Þué‰çÆç¿é?ënèˆäVê²åøå¯êÔìäá&Þ¬áÊÝùìÚñÁñ'íDõÚ÷Üôºüäö“þÄû’õõúTþióŽøòú<ÿ èý×< ­ ¿Z † +N ¼ W:nA¾UÉ“!¨ F 9ÅŠ Ÿ3ˆb |i s¤–i¦ ÒTn²B ½)¹ ê 3 âͬ“'¤IŠ:V|DÑø3˜öä¬! »Ð Æý}ü4ú&ÃnÚ M\Ò<ý´ÿ)8ù£ôÐðÙòqýþ&úùöbüº!ýhúÁüŒ›ûìÔù†^ùuúËûøAö³ñ™öàþ5þÞù«öà”Hz€ ßø|ó£ïLënïöìë«ï íyézê„îãæßæäååæråYàXßxÙÂØâÓ;èèµçÐè–îAñöôÝõææ>åŽêhëÍàÓÛ’×wÒ,ÐÒ±Ë@í ñ–ïãíIõáùíøtñ6ïÎôòçî1éöéYäÖøýý7q ¤ üó l  PÁ÷` Åî8C W#’}!{ ¡${$ý#™&‚$8+ˆ'±,)':+ (×+Ê/Š-É)÷0…#±!!!ªŸ$C$õ =š)Þ.Ü3Ô3Ê7ÌWylhe!4Û#° €á!M­\Y jôÀ Æ}þù÷Žü\ø{÷þøS÷Sø óñï/ï^ö7ëæ!ä$ä âFÞ¯ÛŸÛËØââÐàÑÜ)ÚºäÖåßéãÙíÕ‚×8Ô#ÓBÐaÎ ËÑÏàÜ/ÞBßßÈãáßäóÝTàTáŽä“ä§çEê6ïžð(ç鳿Sá‡èÍóœøÙüöû«ç3 { Î V] ‡M˜ *? ÑÝ h ˆ hf¥Ù´«àçTYIy®ëµN"Ê%ë#Â+z- V©ã¥!Џ# ÍÀ Z tëØ;.<SàûóJ ún÷-ùCûÏöÎòîgë$èëê‘æ­í‚êÙçßêÂéYâQÞgßÄÙ}îéò3õùàöóLòl _ )$N+æ¡þ“"&Æ+F/ƒ(>(H$j*n.‰-Ã)r.w)E)ª#`21Y/6/Ö6è:7‰,k*+.f2R&™)”+D-Ì1Ê1-¢07*h)¥5©5Ñ2ò2;‡>ÞD¡=H1.I2Q6ÿ-,L0—0ž4k7†5t1+˜+^<ÂW¼8|‚"à$g‹ %°*æ/ 3È+Ò*i(ƒ-s0û0+ã/Ñ* (¨" 4*3[0&08ð;Î9±-,*-Ž1ù&k)¨,^+µ//›,P,&‹&Â3¸4Œ0¤.~: >àC®>’/]+¯.Q3+F, 0Š+B-u/«.€(É$:%2‰¬¥Ãþ É» ä’ÓÐÜù;þm:% ä È7ÿ.ã&Oé)9D~ã¸øyøyý¾çâ"y/i b#+Ù2 ù¦öûì“í¡Öü©&m ¦,ΦZû MÐ)ÓNF$róÈÊ §éþ a BÑïÙÃ÷“÷ 5&çM,VÖ×ø¯Ρ4RG' Oò?ñ+èëÛp‚<â&F/ã$ß¿¶Ä;ÖtÜÆÔ`*›ðÏñ¼ãÝÙ”.?Ì&™r?J%ðPAµöت@ípõûÓ ‰åˆ÷qÓÜ#þæÅw)çôò½ '¸õ—£€0€FJE Ae<éCëF¾KlCûBÃ??÷Dl?Ø;ì6‡=»;²;ã84ò:q>?bA|C3EPF+8f4ê3<6:7™;å3£.\,1..¢&80B2€.H.Û6Y;ª>>¿*.%÷ Ë  &€+ú.“.Š3ž36;šIbkXïKCò s iÔfËžiâ…™ë‘úÜnÿMû]÷œý3ü ø’÷Õø<ú_ö£õØúºþÄúYþ¸:ýçØüÕNþ ÷>ÐË”¶¢¸gœäË ï *ø - L @ ×hŸq ( Ž=ýí ôÎ6XÕÁ¯ŠM± 9ƒ!ú#î#+(ï)È'Y*6'„) '^)E#à!Ë%¼(Cȶ——&,)¶'6"n+).•,„,ë*¬*r(z,ˆ1@&f*,&':* -ÿ-‹)/,5.?.o)R(l,N#Ÿ221À4ë6÷7c6 -ì-:/ˆ0Ý'e$”µ&/ë21ô0F3—3Ý1ú1R9< ;‹>ú=ßAZ@ÅC$0ó/c4}8º+š."1˜,c4$8Ð=A›7O5¥0œ8e0T5;œ??éA´>×9‡86š>>1;hòDE·B•F“LDõJK£LåNÔPcRÊN K¤L¼PvO<G¼ICÏUYm^Ë_¡X=U0T]SˆbUg¹jonEgèmh®Bº??BbFò:‹55‚1$@B¶BŠ>V@ƒCBõIFG)GËKµNˆIôF DKD@ž@h>¯KûO¯RtP8LüIrQWsZ€Y9XÆ`hXÍW¡\“\{TzOgM KÉ`ÏeÁjbiÕf:a9_ ^¾ZxZ5XSªnôsÇu*texNxdt^|”w^y}ê}àt¿v˜w„w€yYyPz=‚5‡ˆ7ˆ‹ÊŠâŒ³‰JŠ}Žè’æ‹ôŽA’2’à“©‹p“%“ËŽ›ŠwŽÜŠ;†Ï‚ ‡ ŠÅˆÝ‰F†‚‚t~:ƒêÏ~„Xƒº€71…9€Û†F~k}~}iyûyáy}Ss¾€Ø€¢|H{¢…̉ÖyMtþtåw onŠoaieryrljitêszØkdf2cÞf1fba a9[¹[_4\Œ]@Zc`ùb]·[{gGi"n”p­pÆ\tX_Z·_ZV9SQ|ONŒW•Y~UCP›[£]ÿY´aaVñShT-X›TåT!S}TfY]EY¤OõPlOˆK¦LK¤NªS7R÷PÚNXb[W`ÄX[QßPQÙT€P€QðTTM JÐGãKÔF JGEUW2YUcQ^„]bY†`¾V¡RàP:KlUcQM Q…J†MSIQ OM8TÙYÊYÒ^ OYMiP}N×TùX%[ƒ\ö[ƒX?[z_èY‰\Î`\ÉYˆdòhêi²lÀmÉo¿møsæru]ë[,_ bØW÷U^}b`.[Þb¬g%hðežm¹cjbežiöbcÕf»fqb:dg–d‰e±`|jèknÆpÓmjrÂjUoÎsexá{ís~n{oiàe¸z.€„”€L€l~•‚ˆ{þ|ÑxVtynu€wš|4tpcobootMvr-ns›pp0t\q,p°t…l r„mRfãi¢c=d¤kjìfüd#hÞlqcQfûc@]ª\¨dçjmj5ZT–QùN·QqS2SNP÷SñSOýTòY;TjWsZSWãYÌ`c¾bÍh=f?k³j¬nS¿Q+K;IRjOòXVP¼H˜Bè@»CZAZ<Aü;û9Ã86¹5*3_8Š806{1ë2,:Ð8“?a-Ô)%¼%p*b&2"U&õ#Kõ.s#['eÿ‹Ñ¹Å³Z~d^ók¼*Øv õ g}:¢Ç á iGK¡z p™Œ!›!o!ü$²&4)ÿ&¥EÅ%>(‘Œª&Ç+Ñ+K&ô-`.ì.Ã4X/§/{-ˆ.‡5:7c4Ü*ž(²-1i%€'ž(‹+øroq,u"wlk¡uÜy—xƒsùxðw:sJ|º|q|S|k-…倴{ÿ{çvàt”€¡J†„1tæpq†v nusvmÄooŽm¶jReôhQrCr¸mdiúv”u¢ulªg»gbkYgthˆfÙebšbdŠd[\%Z5]xgi|e`Ölzi0gÑgE = þ Æ ü¿y3z}s¸{\{Z±BqJüR-ü>è o$ûùúá3ÄG= D¡.ÿ-ìW)D!OXRöÿC(jLŠ€[J‹Lwà‰[­û6 2ðnrÜ,(ï%&;t7Œ<–JÍ©"ª$ÁK#ïÿ,ΞQ báŽôê¨jób­4$"(1!ƒ N'}& #((Ÿ3þ/Š:ò9CO$rù$†'¯3ÃÚÃ"($q ”­Jž#<(¾5û'}¼ ©Dk NŸv”¨.Ë$™ê'õX£ü¬¶#•ô݉2_ Ù'ÿþ"B§¡)!#ú%ãÞ(ï'¯"s- JVUút„ "B£%Æ1.0ñ(7´LR9QÂe+/52ú(1F•ZwtšŒE-P1K1.r<ðIoRG™.@1.51›9&FïOKmAtêq)c-3556-45è,.)þ- 2È53:4NDLJ=š04.J*²½#Ò///M3+¬.¸0y-æ4v(Y/²BÖ,¯,V49Ú!)"Ã$6'8g@8?ò99IƒVêY¯[]dwbÀAï@8@õFnC÷S=f/H¼:p;¦5>;’)Á,A&*$;Äg[ƒ,Œ– ±sÀ?Ðu=¢Ð; ëÒ²"’$6Õ*øQ"Õ"›"jü+oKe!qƒvû𘧲žÆ#ï' Ï+e7m8Ö1.­2Ò."7<1.5û,‡/:=N¡OURM]Ôu䉌–“0QÖX\Sƒ`5[o|äL!HãGH@.?µ6’1ØM€pv€‰÷‘(ÜÂ"º"ÃK©]  ¨õ6õW>ß“P9ê­ÅbI”}cÏãÒ ã£$T'-&¢&HF1!˜2Ò.3ÂJÃm‡x€%p¤Œ  ÐŽ öÚ"_“ È?!p%CÊq!ÛYß 5$Á¤/%.ô(–"#+¿7•2-2c0ûL@egoqyhBg)k&|ë}wI–2÷s"ž€>{Ênhö”>£µ²¡«ý^ˆL D«;LHXJìTëXe6`%î$I! ,..Â63¤9aCb;B;ȳÉ&˜ ‰$ÕË‚ï¬Ç ”]‰}$,›hÝ,Û–)˺*:µ0—FŸK–ÌŽ$I*Ð't;åpSžÐ×ÒT­ú’Õ%»ß3ßœ!«+-–x3…>C=ýJsK pl6â.J*í& "° ÷ø&µ*ãP+—õ(PTF8Ë$Á]”>ÿ1! \° ‚Úï ±îµ î#OÝ"B¯twÌydð)IœsÊ$†2å ê"¥w*07ŸAæSQYià‘ñ"#ûLq¡&µ2Z4:Ý· N!¡ ä%Ð7<Aæ`,s< $^%a!ñ/>äB?HX't1õ0è2å=_dt6‚³ƒŒZˆ¸++¬0—186s/ä%a.@6j11KD=T›WäW%*0'¯-F,ö'L(n(O(w$Ö2î]#d#m"’&À(Ç5¶=!7•&À1‘3 /%F‹S=OõMWnZ’J£¬ ‚ª´ª‚E-@¥ADGôTtJ×X;}5Ê4l2 2½8?-Y)™AÜ]Qo5nx€«*b'B%¨p”q'öÒLé¯ÐÐ$-–)ó+Ê1.U'Í&[#å„2ªOâp²s †Ø!ñ%»'œ%“%N*¨5H8ó/÷DñWXmˆlGq3,8CDQ2‚=#åTÄfNh’l¡y=˜:œIª½`I`"]ñf»b—sæzív4PŸ@~=^=4l4Ð1›ÚºàN«Í ŠQ‰ÞäQ¼¢´æUw*kWNÉI¬T•¦'Íal|Ę÷X)aZŒt®™\v¥;¥Û‹ÃÝ]³°„Љ»˜`Lêµr±0Âc`»W…>ÍùÁ>ÛKÍ–;–'Ût¢€ £€M«/¥€0€ €B@¡€Çõù¢€éCÉ£€^¼ ¦€0€ €B@¡€Ã<6¢€û·£€Mx4§€0€ €B@¡€È+ñ¢€é+u£€^‰0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€ ¢€¡€£€0€ €0€ €B@¡€ð!X¢€Ê壀eÁi¡€0€ €B@¡€ö¼¢€:£º£€h  ¢€0€ €B@¡€ïâÓ¢€Úµ£€e•O£€0€ €B@¡€õÓ7¢€:³Š£€g݆¤€0€ €B@¡€iÖp¢€(¢%£€(a¡¥€0€ €B@¡€oÆÔ¢€Fzú£€*©Ø¦€0€ €B@¡€i—뢀(±õ£€(5‡§€0€ €B@¡€oˆO¢€FŠÊ£€*}¾0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€£€0€ €0€ €B@¡€JXý¢€öÅÙ£€õÚ³¡€0€ €B@¡€Xß7¢€ ±­£€Ñf¢€0€ €B@¡€Js˜¢€ö”£€ö¹£€0€ €B@¡€XùÒ¢€ 磀l¤€0€ €B@¡€m¢€ÏPI£€vŒÛ¥€0€ €B@¡€ˆ§¢€æ<£€„ƒŽ¦€0€ €B@¡€¢€Ïƒ£€vÂá§€0€ €B@¡€£B¢€æ X£€„¹”0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€£€0€ €0€ €B@¡€É_¢€žz£€„쟡€0€ €B@¡€Ó)¥¢€£®õ£€h•‚¢€0€ €B@¡€Éꢀž@Ì£€„ÝÝ£€0€ €B@¡€Ó'0¢€£bG£€h†À¤€0€ €B@¡€²—¢€°£€Gß·¥€0€ €B@¡€ÉÝ¢€µ7=£€+ˆš¦€0€ €B@¡€°"¢€¯É£€GÐõ§€0€ €B@¡€Çh¢€´ê£€+yØ0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€ ¢€#¡€£€0€ €0€ €B@¡€ëÛÄ¢€Ä飀=¹¡€0€ €B@¡€ÎþÌ¢€¿$|£€4|A¢€0€ €B@¡€ëÈâ€Ä•£€=^~£€0€ €B@¡€ÎëË¢€¿(£€4Ƥ€0€ €B@¡€É–T¢€]:ð£€X9ñ¥€0€ €B@¡€¬¹\¢€XKƒ£€O¡y¦€0€ €B@¡€ɃS¢€])œ£€Xƒ¶§€0€ €B@¡€¬¦[¢€X:/£€Oë>0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€(¢€.¡€£€0€ €0€ €B@¡€ô²=¢€Y —£€xMR¡€0€ €B@¡€è ¢€M’£€_6â€0€ €B@¡€ôò"¢€Y£€x$\£€0€ €B@¡€èRò¢€M.£€_ ͤ€0€ €B@¡€iε¢€ÿTÃÈ£€¹F"¥€0€ €B@¡€]/…¢€ÿHÒ〠/“¦€0€ €B@¡€jš¢€ÿTÖN£€¹,§€0€ €B@¡€]oj¢€ÿHåI£€ 0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€/¢€5¡€£€0€ €0€ €B@¡€9(U¢€‚­“£€äø¡€0€ €B@¡€?’ª¢€–ݼ£€ÜÙ¢€0€ €B@¡€9t¢€‚ªE£€Ñ检0€ €B@¡€?ÞZ¢€–Ún£€ÉǤ€0€ €B@¡€0½¢€9_£€cW ¥€0€ €B@¡€›¢€MC£€yO¦€0€ €B@¡€|m¢€9[Ì£€cD§€0€ €B@¡€æÂ¢€M‹õ£€y;ï0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€8¢€<¡€£€0€ €0€ €B@¡€˜ÐꢀdlŽ£€Fð¡€0€ €B@¡€™9¢€Q‹¥£€^‡õ¢€0€ €B@¡€˜‚Ö¢€dnJ£€Fú£€0€ €B@¡€˜¸%¢€Qa£€^‰ÿ¤€0€ €B@¡€’º¢€Å>£€ÉG ¥€0€ €B@¡€’8 ¢€²]¦£€áA¥¦€0€ €B@¡€‘´¦¢€Å@K£€ÉIª§€0€ €B@¡€‘éõ¢€²_b£€áC¯¡€1€¡€0€£€  ¦€1€´€0€ €¡€0€ €Ë¡€¢€¡€Complex (KinasePEPTIDE)¢€0€cCrystal Structure Of The Complex Of The Abl Tyrosine Kinase Sh3 Domain With 3bp-1 Synthetic Peptide£€0€¤Mol_id: 1; Organism_scientific: Mus Musculus; Organism_common: Mouse; Expression_system: Escherichia Coli; Expression_system_plasmid: Pet; Mol_id: 2; Synthetic: Yes¤€X-Ray Diffraction¦€)Revision History:~OCT 15 95 Initial Entry«€0€ €1€¡€0€ €0€ € €0€0€ €¡€0€ € Musacchio£€ A.Musacchio¤€A.0€ €¡€0€ €Wilmanns£€ M.Wilmanns¤€M.0€ €¡€0€ €Saraste£€ M.Saraste¤€M.£€¡€0€ €Ë¡€¢€«€0€ €1€£€¯•®¤€0€ €1€ €gHigh-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.¡€0€ € €0€0€ €¡€0€ € Musacchio¤€A.0€ €¡€0€ €Saraste¤€M.0€ €¡€0€ €Wilmanns¤€M.¡€ €;European Molecular Biology Laboratory, Heidelberg, Germany.¢€ €0€ €1€¤€Nat. Struct. Biol.¥€Nat Struct Biol§€ 1072-8368£€B98¡€0€ €¡€0€ €Ê¡€¡€1¢€8£€546-551«€0€ €1€£€†¤€0€ €1€ €‘Crystal structure of the SH3 domain in human Fyn; comparison of the three-dimensional structures of SH3 domains in tyrosine kinases and spectrin.¡€0€ € €0€0€ €¡€0€ €Noble¤€M.E.0€ €¡€0€ € Musacchio¤€A.0€ €¡€0€ €Saraste¤€M.0€ €¡€0€ € Courtneidge¤€S.A.0€ €¡€0€ €Wierenga¤€R.K.¡€ €EMBL, Heidelberg, Germany.¢€ €0€ €1€¤€EMBO J.¥€EMBO J§€ 0261-4189£€EMB¡€0€ €¡€0€ €É¡€¡€12¢€7£€ 2617-2624«€0€ €1€£€º¤€0€ €1€ €AIdentification of a ten-amino acid proline-rich SH3 binding site.¡€0€ € €0€0€ €¡€0€ €Ren¤€R.0€ €¡€0€ €Mayer¤€B.J.0€ €¡€0€ € Cicchetti¤€P.0€ €¡€0€ € Baltimore¤€D.¡€ €+Rockefeller University, New York, NY 10021.¢€ €0€ €1€¤€Science¥€Science§€ 0036-8075£€UJ7¡€0€ €¡€0€ €É¡€¢€¡€259¢€5098£€ 1157-1161«€0€ €1€£€Œƒ¤€0€ €1€ €3Crystal structure of a Src-homology 3 (SH3) domain.¡€0€ € €0€0€ €¡€0€ € Musacchio¤€A.0€ €¡€0€ €Noble¤€M.0€ €¡€0€ €Pauptit¤€R.0€ €¡€0€ €Wierenga¤€R.0€ €¡€0€ €Saraste¤€M.¡€ €;European Molecular Biology Laboratory, Heidelberg, Germany.¢€ €0€ €1€¤€Nature¥€Nature§€ 0028-0836£€NSC¡€0€ €¡€0€ €È¡€ ¢€¡€359¢€6398£€851-855§€0€ €0€ €1€®€0€ €1ABO¡€A¢€¡€0€ €Ë¡€¢€«€²¡€1€¶€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€kEukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD§€¡€0€ €>¡€0€646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121¢€0€ € ¡€ ¢€>¦€§€A>MNDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS£€1€0€¤€ €1€0€¡€°€ ¤€strand 1¦€£€0€ €¡€ £€«€²0€¡€°€ ¤€strand 2¦€£€0€ € ¡€£€«€²0€¡€°€ ¤€strand 3¦€£€0€ €¡€£€«€²0€¡€°€ ¤€strand 4¦€£€0€ €¡€£€«€²0€¡€°€ ¤€strand 5¦€£€0€ €¡€"£€«€²0€¡€°€ ¤€strand 6¦€£€0€ €'¡€-£€«€²0€¡€°€ ¤€strand 7¦€£€0€ €.¡€4£€«€²0€¡€°€ ¤€strand 8¦€£€0€ €7¡€;£€«€² €0€ €1€®€0€ €1ABO¡€B¢€¡€0€ €Ë¡€¢€«€³¡€1€¶€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€kEukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD§€¡€0€ €>¡€0€646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121µ€(SO4, 410 ) Sulfate Ionµ€(SO4, 411 ) Sulfate Ion¢€0€ € ¡€ ¢€>¦€§€A>MNDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS£€1€0€¤€ €1€0€¡€°€ ¤€strand 9¦€£€0€ €¡€£€«€³0€¡€°€ ¤€ strand 10¦€£€0€ € ¡€£€«€³0€¡€°€ ¤€ strand 11¦€£€0€ €¡€£€«€³0€¡€°€ ¤€ strand 12¦€£€0€ €¡€£€«€³0€¡€°€ ¤€ strand 13¦€£€0€ €¡€"£€«€³0€¡€°€ ¤€ strand 14¦€£€0€ €'¡€-£€«€³0€¡€°€ ¤€ strand 15¦€£€0€ €.¡€4£€«€³0€¡€°€ ¤€ strand 16¦€£€0€ €7¡€;£€«€³ €0€ €1€®€0€ €1ABO¡€C¢€¡€0€ €Ë¡€¢€«€´¡€1€¶€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€kEukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD§€¡€0€ € ¡€0€12345678910¢€0€ € ¡€ ¢€ ¦€§€A APTMPPPLPP €0€ €1€®€0€ €1ABO¡€D¢€¡€0€ €Ë¡€¢€«€µ¡€1€¶€0€¢€0€ € Mus musculus¡€ house mouse£€1€0€ €taxon¡€ €'j¥€0€ € €0€ €Mus¡€musculus£€kEukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus¤€¥€¦€ROD§€¡€0€ € ¡€0€12345678910¢€0€ € ¡€ ¢€ ¦€§€A APTMPPPLPP