£€0€ €0€ €0€ €;¡€0€ €1MAI¡€remark 3: Refinement.¡€$remark 3: Program : X-Plor 3.1¡€!remark 3: Authors : Brunger¡€$remark 3: Data Used In Refinement.¡€4remark 3: Resolution Range High (Angstroms) : 1.90¡€4remark 3: Resolution Range Low (Angstroms) : 8.00¡€2remark 3: Data Cutoff (Sigma(F)) : 2.¡€4remark 3: Data Cutoff High (Abs(F)) : Null¡€4remark 3: Data Cutoff Low (Abs(F)) : Null¡€4remark 3: Completeness (Working+test) (%) : 99.5¡€5remark 3: Number Of Reflections : 11695¡€+remark 3: Fit To Data Used In Refinement.¡€3remark 3: Cross-Validation Method : Null¡€3remark 3: Free R Value Test Set Selection : Null¡€4remark 3: R Value (Working Set) : 0.205¡€4remark 3: Free R Value : 0.291¡€3remark 3: Free R Value Test Set Size (%) : 10.0¡€3remark 3: Free R Value Test Set Count : Null¡€3remark 3: Estimated Error Of Free R Value : Null¡€.remark 3: Fit In The Highest Resolution Bin.¡€6remark 3: Total Number Of Bins Used : Null¡€6remark 3: Bin Resolution Range High (A) : Null¡€6remark 3: Bin Resolution Range Low (A) : Null¡€6remark 3: Bin Completeness (Working+test) (%) : Null¡€6remark 3: Reflections In Bin (Working Set) : Null¡€6remark 3: Bin R Value (Working Set) : Null¡€6remark 3: Bin Free R Value : Null¡€6remark 3: Bin Free R Value Test Set Size (%) : Null¡€6remark 3: Bin Free R Value Test Set Count : Null¡€6remark 3: Estimated Error Of Bin Free R Value : Null¡€remark 3: Group 1 Positional (A) : Null ; Null¡€remark 200: Experiment Type : X-Ray Diffraction¡€8remark 200: Date Of Data Collection : 15-May-1995¡€0remark 200: Temperature (Kelvin) : 100¡€0remark 200: Ph : 6.5¡€.remark 200: Number Of Crystals Used : 1¡€-remark 200: Synchrotron (YN) : Y¡€1remark 200: Radiation Source : Nsls¡€0remark 200: Beamline : X25¡€1remark 200: X-Ray Generator Model : Null¡€-remark 200: Monochromatic Or Laue (ML) : M¡€0remark 200: Wavelength Or Range (A) : 1.0¡€1remark 200: Monochromator : Null¡€1remark 200: Optics : Null¡€8remark 200: Detector Type : Image Plate¡€8remark 200: Detector Manufacturer : Marresearch¡€2remark 200: Intensity-Integration Software : Denzo¡€1remark 200: Data Scaling Software : Null¡€2remark 200: Number Of Unique Reflections : 11978¡€0remark 200: Resolution Range High (A) : 1.9¡€1remark 200: Resolution Range Low (A) : 40.0¡€0remark 200: Rejection Criteria (Sigma(I)) : 0.0¡€remark 200: Overall.¡€1remark 200: Completeness For Range (%) : 99.7¡€/remark 200: Data Redundancy : 3.¡€2remark 200: R Merge (I) : 0.100¡€2remark 200: R Sym (I) : 0.066¡€0remark 200: FOR THE DATA SET : 16.8¡€,remark 200: In The Highest Resolution Shell.¡€;remark 200: Highest Resolution Shell, Range High (A) : 1.90¡€;remark 200: Highest Resolution Shell, Range Low (A) : 1.96¡€1remark 200: Completeness For Shell (%) : 99.4¡€1remark 200: Data Redundancy In Shell : Null¡€1remark 200: R Merge For Shell (I) : Null¡€1remark 200: R Sym For Shell (I) : 0.38¡€0remark 200: FOR SHELL : 3.22¡€7remark 200: Method Used To Determine The Structure: Mir¡€"remark 200: Software Used: Mlphare¡€ remark 200: Starting Model: Null¡€remark 200: Remark: Null¡€remark 280: Crystal¡€*remark 280: Solvent Content, Vs (%): 45.¡€9remark 280: Matthews Coefficient, Vm (Angstroms3DA): NULL¡€,remark 280: Crystallization Conditions: Null¡€%remark 290: Crystallographic Symmetry¡€9remark 290: Symmetry Operators For Space Group: P 43 21 2¡€remark 290: Symop Symmetry¡€remark 290: Nnnmmm Operator¡€remark 290: 1555 X,Y,Z¡€remark 290: 2555 -X,-Y,12+Z¡€!remark 290: 3555 12-Y,12+X,34+Z¡€!remark 290: 4555 12+Y,12-X,14+Z¡€!remark 290: 5555 12-X,12+Y,34-Z¡€!remark 290: 6555 12+X,12-Y,14-Z¡€remark 290: 7555 Y,X,-Z¡€remark 290: 8555 -Y,-X,12-Z¡€(remark 290: Where Nnn -> Operator Number¡€%remark 290: Mmm -> Translation Vector¡€5remark 290: Crystallographic Symmetry Transformations¡€Cremark 290: The Following Transformations Operate On The AtomHETATM¡€Aremark 290: Records In This Entry To Produce Crystallographically¡€remark 290: Related Molecules.¡€Cremark 290: Smtry1 1 1.000000 0.000000 0.000000 0.00000¡€Cremark 290: Smtry2 1 0.000000 1.000000 0.000000 0.00000¡€Cremark 290: Smtry3 1 0.000000 0.000000 1.000000 0.00000¡€Cremark 290: Smtry1 2 -1.000000 0.000000 0.000000 0.00000¡€Cremark 290: Smtry2 2 0.000000 -1.000000 0.000000 0.00000¡€Cremark 290: Smtry3 2 0.000000 0.000000 1.000000 40.34861¡€Cremark 290: Smtry1 3 0.000000 -1.000000 0.000000 29.70003¡€Cremark 290: Smtry2 3 1.000000 0.000000 0.000000 29.70003¡€Cremark 290: Smtry3 3 0.000000 0.000000 1.000000 60.52291¡€Cremark 290: Smtry1 4 0.000000 1.000000 0.000000 29.70003¡€Cremark 290: Smtry2 4 -1.000000 0.000000 0.000000 29.70003¡€Cremark 290: Smtry3 4 0.000000 0.000000 1.000000 20.17430¡€Cremark 290: Smtry1 5 -1.000000 0.000000 0.000000 29.70003¡€Cremark 290: Smtry2 5 0.000000 1.000000 0.000000 29.70003¡€Cremark 290: Smtry3 5 0.000000 0.000000 -1.000000 60.52291¡€Cremark 290: Smtry1 6 1.000000 0.000000 0.000000 29.70003¡€Cremark 290: Smtry2 6 0.000000 -1.000000 0.000000 29.70003¡€Cremark 290: Smtry3 6 0.000000 0.000000 -1.000000 20.17430¡€Cremark 290: Smtry1 7 0.000000 1.000000 0.000000 0.00000¡€Cremark 290: Smtry2 7 1.000000 0.000000 0.000000 0.00000¡€Cremark 290: Smtry3 7 0.000000 0.000000 -1.000000 0.00000¡€Cremark 290: Smtry1 8 0.000000 -1.000000 0.000000 0.00000¡€Cremark 290: Smtry2 8 -1.000000 0.000000 0.000000 0.00000¡€Cremark 290: Smtry3 8 0.000000 0.000000 -1.000000 40.34861¡€remark 290: Remark: Null¡€remark 525: Solvent¡€Eremark 525: The Following Solvent Molecules Lie Farther Than Expected¡€@remark 525: From The Protein Or Nucleic Acid Molecule And May Be¡€?remark 525: Associated With A Symmetry Related Molecule (Mmodel¡€Dremark 525: Number; Resresidue Name; Cchain Identifier; Sseqsequence¡€%remark 525: Number; Iinsertion Code):¡€remark 525: M Res Csseqi¡€7remark 525: 0 Hoh 82 Distance 5.10 Angstroms¡€remark 999: Sequence¡€Gremark 999: 1mai Sws P10688 1 - 11 Not In Atoms List¡€Gremark 999: 1mai Sws P10688 131 - 756 Not In Atoms List¡€>remark 999: Met A 10 Is An Initiator Codon At The Start Of The¡€remark 999: Expressed Domain.¡€CDbref 1mai 12 130 Sws P10688 Pip6_rat 12 130£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €Ì¡€ ¢€¢€¡€0€ €PDB¡€¡€1MAI£€¡€0€ €Ì¡€¢€¤€¡€0€ €0€ € €0€0€ €¡€0€ €Ferguson£€ K.M.Ferguson¤€K.M.0€ €¡€0€ €Lemmon£€ M.A.Lemmon¤€M.A.0€ €¡€0€ € Schlessinger£€J.Schlessinger¤€J.0€ €¡€0€ €Sigler£€ P.B.Sigler¤€P.B.¡€0€ €¡€0€ €Ì¡€¢€¤€«€1€£€º{N¤€0€ €1€ €sStructure of the high affinity complex of inositol trisphosphate with a phospholipase C pleckstrin homology domain.¡€0€ € €0€0€ €¡€0€ €Ferguson¤€K.M.0€ €¡€0€ €Lemmon¤€M.A.0€ €¡€0€ € Schlessinger¤€J.0€ €¡€0€ €Sigler¤€P.B.¡€ €LDepartment of Chemistry, Yale University, New Haven, Connecticut 06510, USA.¢€ €0€ €1€¤€Cell¥€Cell§€ 0092-8674£€CQ4¡€0€ €¡€0€ €Ë¡€ ¢€¡€83¢€6£€ 1037-1046¢€0€ €0€ €mStructure Of The Pleckstrin Homology Domain From Phospholipase C Delta In Complex With Inositol Trisphosphate£€‚ˆStructure Of The Pleckstrin Homology Domain From Phospholipase C Delta In Complex With Inositol Trisphosphate Pleckstrin, Phospholipase, Inositol Trisphosphate, Signal Transduction Protein, Hydrolase Mol_id: 1; Molecule: Phospholipase C Delta-1; Chain: Null; Fragment: Pleckstrin Homology Domain; Ec: 3.1.4.11; Engineered: Yes; Other_details: Complexed With D-Myo-Inositol-1,4,5-Trisphosphate¡€Signal Transduction Protein¢€}Mol_id: 1; Organism_scientific: Rattus Norvegicus; Organism_common: Rat; Plasmid: Pet11a; Expression_system: Escherichia Coli¡€0€0€ €¡€0€ € £€SEQRES¨€¥€0€¢€0€ €Rattus norvegicus¡€ Norway rat£€1€0€ €taxon¡€ €'„¥€0€ € €0€ €Rattus¡€ norvegicus£€‰Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Rattus¤€¥€¦€ROD¢€«€§½£€0€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€'0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ € ¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €!¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €"¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €#¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €&¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €'¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €(¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €)¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €*¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €+¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €,¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €-¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €/¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €0¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €1¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €2¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €3¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €5¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €6¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €8¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €;¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €<¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €=¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €?¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €A¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €B¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €C¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €D¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €E¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €G¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €H¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €I¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €J¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €L¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €N¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €O¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €P¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €R¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €T¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €V¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €W¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €X¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Y¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €Z¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €[¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €\¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €]¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €^¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €_¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €`¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €a¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €b¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €c¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €d¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €e¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €f¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €g¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €h¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €i¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €j¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €k¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €m¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €n¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €p¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €q¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €r¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €s¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 125 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 126 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €v¡€ 127 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €w¡€ 128 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 129 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €y¡€ 130 ¢€ €0€ €z¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €{¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €|¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €~¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €€¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‚¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ƒ¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€#¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€ 0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€0€ €0€ €¡€$¢€¡€0€ €¡€%¢€ 0€ €0€ €¡€%¢€¡€0€ €¡€&¢€ 0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€ 0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€ 0€ €0€ €¡€*¢€¡€0€ €¡€+¢€0€ €0€ €¡€+¢€¡€0€ €¡€,¢€0€ €0€ €¡€,¢€¡€0€ €¡€-¢€ 0€ €0€ €¡€-¢€¡€0€ €¡€.¢€0€ €0€ €¡€.¢€¡€0€ €¡€/¢€ 0€ €0€ €¡€/¢€¡€0€ €¡€0¢€ 0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€0€ €0€ €¡€8¢€¡€0€ €¡€9¢€ 0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€ 0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€0€ €0€ €¡€@¢€¡€0€ €¡€A¢€ 0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€0€ €0€ €¡€D¢€¡€0€ €¡€E¢€0€ €0€ €¡€E¢€¡€0€ €¡€F¢€ 0€ €0€ €¡€F¢€¡€0€ €¡€G¢€ 0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€ 0€ €0€ €¡€I¢€¡€0€ €¡€J¢€0€ €0€ €¡€J¢€¡€0€ €¡€K¢€ 0€ €0€ €¡€K¢€¡€0€ €¡€L¢€ 0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€0€ €0€ €¡€N¢€¡€0€ €¡€O¢€0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€ 0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€0€ €0€ €¡€S¢€¡€0€ €¡€T¢€ 0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€ 0€ €0€ €¡€V¢€¡€0€ €¡€W¢€0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€ 0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€ 0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€ 0€ €0€ €¡€^¢€¡€0€ €¡€_¢€0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€0€ €0€ €¡€a¢€¡€0€ €¡€b¢€ 0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€ 0€ €0€ €¡€d¢€¡€0€ €¡€e¢€ 0€ €0€ €¡€e¢€¡€0€ €¡€f¢€ 0€ €0€ €¡€f¢€¡€0€ €¡€g¢€0€ €0€ €¡€g¢€¡€0€ €¡€h¢€0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€0€ €0€ €¡€k¢€¡€0€ €¡€l¢€ 0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€0€ €0€ €¡€n¢€¡€0€ €¡€o¢€ 0€ €0€ €¡€o¢€¡€0€ €¡€p¢€0€ €0€ €¡€p¢€¡€0€ €¡€q¢€ 0€ €0€ €¡€q¢€¡€0€ €¡€r¢€0€ €0€ €¡€r¢€¡€0€ €¡€s¢€0€ €0€ €¡€s¢€¡€0€ €¡€t¢€ 0€ €0€ €¡€t¢€¡€0€ €¡€u¢€ 0€ €0€ €¡€u¢€¡€0€ €¡€v¢€ 0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€ 0€ €0€ €¡€x¢€¡€0€ €¡€y¢€0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€0€ €0€ €¡€~¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€‚¢€0€ €0€ €¡€‚¢€¡€0€ €¡€ƒ¢€ 0€ €¡€0€ €1¨€£€0€0€ €¡€ 200 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 1 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 2 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 3 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 4 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 5 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 6 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 7 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 8 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 9 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 10 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 11 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 12 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 13 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 14 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 15 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 16 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 17 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 18 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 19 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 20 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 21 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 22 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 23 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 24 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 25 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 26 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 27 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 28 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 29 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 30 ¢€ €0€ €!¡€0€ €1¨€£€0€0€ €¡€ 31 ¢€ €0€ €"¡€0€ €1¨€£€0€0€ €¡€ 32 ¢€ €0€ €#¡€0€ €1¨€£€0€0€ €¡€ 33 ¢€ €0€ €$¡€0€ €1¨€£€0€0€ €¡€ 34 ¢€ €0€ €%¡€0€ €1¨€£€0€0€ €¡€ 35 ¢€ €0€ €&¡€0€ €1¨€£€0€0€ €¡€ 36 ¢€ €0€ €'¡€0€ €1¨€£€0€0€ €¡€ 37 ¢€ €0€ €(¡€0€ €1¨€£€0€0€ €¡€ 38 ¢€ €0€ €)¡€0€ €1¨€£€0€0€ €¡€ 39 ¢€ €0€ €*¡€0€ €1¨€£€0€0€ €¡€ 40 ¢€ €0€ €+¡€0€ €1¨€£€0€0€ €¡€ 41 ¢€ €0€ €,¡€0€ €1¨€£€0€0€ €¡€ 42 ¢€ €0€ €-¡€0€ €1¨€£€0€0€ €¡€ 43 ¢€ €0€ €.¡€0€ €1¨€£€0€0€ €¡€ 44 ¢€ €0€ €/¡€0€ €1¨€£€0€0€ €¡€ 45 ¢€ €0€ €0¡€0€ €1¨€£€0€0€ €¡€ 46 ¢€ €0€ €1¡€0€ €1¨€£€0€0€ €¡€ 47 ¢€ €0€ €2¡€0€ €1¨€£€0€0€ €¡€ 48 ¢€ €0€ €3¡€0€ €1¨€£€0€0€ €¡€ 49 ¢€ €0€ €4¡€0€ €1¨€£€0€0€ €¡€ 50 ¢€ €0€ €5¡€0€ €1¨€£€0€0€ €¡€ 51 ¢€ €0€ €6¡€0€ €1¨€£€0€0€ €¡€ 52 ¢€ €0€ €7¡€0€ €1¨€£€0€0€ €¡€ 53 ¢€ €0€ €8¡€0€ €1¨€£€0€0€ €¡€ 54 ¢€ €0€ €9¡€0€ €1¨€£€0€0€ €¡€ 55 ¢€ €0€ €:¡€0€ €1¨€£€0€0€ €¡€ 56 ¢€ €0€ €;¡€0€ €1¨€£€0€0€ €¡€ 57 ¢€ €0€ €<¡€0€ €1¨€£€0€0€ €¡€ 58 ¢€ €0€ €=¡€0€ €1¨€£€0€0€ €¡€ 59 ¢€ €0€ €>¡€0€ €1¨€£€0€0€ €¡€ 60 ¢€ €0€ €?¡€0€ €1¨€£€0€0€ €¡€ 61 ¢€ €0€ €@¡€0€ €1¨€£€0€0€ €¡€ 62 ¢€ €0€ €A¡€0€ €1¨€£€0€0€ €¡€ 63 ¢€ €0€ €B¡€0€ €1¨€£€0€0€ €¡€ 64 ¢€ €0€ €C¡€0€ €1¨€£€0€0€ €¡€ 65 ¢€ €0€ €D¡€0€ €1¨€£€0€0€ €¡€ 66 ¢€ €0€ €E¡€0€ €1¨€£€0€0€ €¡€ 67 ¢€ €0€ €F¡€0€ €1¨€£€0€0€ €¡€ 68 ¢€ €0€ €G¡€0€ €1¨€£€0€0€ €¡€ 69 ¢€ €0€ €H¡€0€ €1¨€£€0€0€ €¡€ 70 ¢€ €0€ €I¡€0€ €1¨€£€0€0€ €¡€ 71 ¢€ €0€ €J¡€0€ €1¨€£€0€0€ €¡€ 72 ¢€ €0€ €K¡€0€ €1¨€£€0€0€ €¡€ 73 ¢€ €0€ €L¡€0€ €1¨€£€0€0€ €¡€ 74 ¢€ €0€ €M¡€0€ €1¨€£€0€0€ €¡€ 75 ¢€ €0€ €N¡€0€ €1¨€£€0€0€ €¡€ 76 ¢€ €0€ €O¡€0€ €1¨€£€0€0€ €¡€ 77 ¢€ €0€ €P¡€0€ €1¨€£€0€0€ €¡€ 78 ¢€ €0€ €Q¡€0€ €1¨€£€0€0€ €¡€ 79 ¢€ €0€ €R¡€0€ €1¨€£€0€0€ €¡€ 80 ¢€ €0€ €S¡€0€ €1¨€£€0€0€ €¡€ 81 ¢€ €0€ €T¡€0€ €1¨€£€0€0€ €¡€ 82 ¢€ €0€ €U¡€0€ €1¨€£€0€0€ €¡€ 83 ¢€ €0€ €V¡€0€ €1¨€£€0€0€ €¡€ 84 ¢€ €0€ €W¡€0€ €1¨€£€0€0€ €¡€ 85 ¢€ €0€ €X¡€0€ €1¨€£€0€0€ €¡€ 86 ¢€ €0€ €Y¡€0€ €1¨€£€0€0€ €¡€ 87 ¢€ €0€ €Z¡€0€ €1¨€£€0€0€ €¡€ 88 ¢€ €0€ €[¡€0€ €1¨€£€0€0€ €¡€ 89 ¢€ €0€ €\¡€0€ €1¨€£€0€0€ €¡€ 90 ¢€ €0€ €]¡€0€ €1¨€£€0€0€ €¡€ 91 ¢€ €0€ €^¡€0€ €1¨€£€0€0€ €¡€ 92 ¢€ €0€ €_¡€0€ €1¨€£€0€0€ €¡€ 93 ¢€ €0€ €`¡€0€ €1¨€£€0€0€ €¡€ 94 ¢€ €0€ €a¡€0€ €1¨€£€0€0€ €¡€ 95 ¢€ €0€ €b¡€0€ €1¨€£€0€0€ €¡€ 96 ¢€ €0€ €c¡€0€ €1¨€£€0€0€ €¡€ 97 ¢€ €0€ €d¡€0€ €1¨€£€0€0€ €¡€ 98 ¢€ €0€ €e¡€0€ €1¨€£€0€0€ €¡€ 99 ¢€ €0€ €f¡€0€ €1¨€£€0€0€ €¡€ 100 ¢€ €0€ €g¡€0€ €1¨€£€0€0€ €¡€ 101 ¢€ €0€ €h¡€0€ €1¨€£€0€0€ €¡€ 102 ¢€ €0€ €i¡€0€ €1¨€£€0€0€ €¡€ 103 ¢€ €0€ €j¡€0€ €1¨€£€0€0€ €¡€ 104 ¢€ €0€ €k¡€0€ €1¨€£€0€0€ €¡€ 105 ¢€ €0€ €l¡€0€ €1¨€£€0€0€ €¡€ 106 ¢€ €0€ €m¡€0€ €1¨€£€0€0€ €¡€ 107 ¢€ €0€ €n¡€0€ €1¨€£€0€0€ €¡€ 108 ¢€ €0€ €o¡€0€ €1¨€£€0€0€ €¡€ 109 ¢€ €0€ €p¡€0€ €1¨€£€0€0€ €¡€ 110 ¢€ €£€0€0€ €¡€0€ €HIS£€¢€£€0€H¤€0€0€ €¡€ N ¢€0€ N £€ 0€ €¡€ CA ¢€0€ CA £€ 0€ €¡€ C ¢€0€ C £€ 0€ €¡€ O ¢€0€ O £€ 0€ €¡€ CB ¢€0€ CB £€ 0€ €¡€ CG ¢€0€ CG £€ 0€ €¡€ ND1¢€0€ ND1£€ 0€ €¡€ CD2¢€0€ CD2£€ 0€ € ¡€ CE1¢€0€ CE1£€ 0€ € ¡€ NE2¢€0€ NE2£€ 0€ € ¡€ OXT¢€0€ OXT£€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ €¡€0€ €I3P£€¢€ÿ£€0€X¤€0€0€ €¡€ C1 ¢€0€ C1 £€ 0€ €¡€ C2 ¢€0€ C2 £€ 0€ €¡€ C3 ¢€0€ C3 £€ 0€ €¡€ C4 ¢€0€ C4 £€ 0€ €¡€ C5 ¢€0€ C5 £€ 0€ €¡€ C6 ¢€0€ C6 £€ 0€ €¡€ O1 ¢€0€ O1 £€ 0€ €¡€ O2 ¢€0€ O2 £€ 0€ € ¡€ O3 ¢€0€ O3 £€ 0€ € ¡€ O4 ¢€0€ O4 £€ 0€ € ¡€ O5 ¢€0€ O5 £€ 0€ € ¡€ O6 ¢€0€ O6 £€ 0€ € ¡€ P1 ¢€0€ P1 £€ 0€ €¡€ O11¢€0€ O11£€ 0€ €¡€ O12¢€0€ O12£€ 0€ €¡€ O13¢€0€ O13£€ 0€ €¡€ P4 ¢€0€ P4 £€ 0€ €¡€ O41¢€0€ O41£€ 0€ €¡€ O42¢€0€ O42£€ 0€ €¡€ O43¢€0€ O43£€ 0€ €¡€ P5 ¢€0€ P5 £€ 0€ €¡€ O51¢€0€ O51£€ 0€ €¡€ O52¢€0€ O52£€ 0€ €¡€ O53¢€0€ O53£€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ € ¡€¢€ÿ0€ € ¡€¢€ÿ0€ € ¡€¢€ÿ0€ € ¡€¢€ÿ0€ € ¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€0€ €HOH£€¢€ÿ£€0€X¤€0€0€ €¡€ O ¢€0€ O £€ ¥€0€£€0€0€ €¡€0€ €PDB secondary structure¢€0€0€ €¡€ 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€ 2¢€¤€ €¡€¡€0€0€ €¡€<¢€>0€ €¡€ 3¢€¤€ €¡€¡€0€0€ €¡€I¢€N0€ €¡€ 4¢€¤€ €¡€¡€0€0€ €¡€T¢€V0€ €¡€ 5¢€¤€ €¡€¡€0€0€ €¡€j¢€w0€ €¡€ A 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€ A 2¢€¤€ €¡€¡€0€0€ €¡€¢€#0€ €¡€ A 3¢€¤€ €¡€¡€0€0€ €¡€)¢€,0€ € ¡€ A 4¢€¤€ €¡€¡€0€0€ €¡€9¢€;0€ € ¡€ B 1¢€¤€ €¡€¡€0€0€ €¡€c¢€f0€ € ¡€ B 2¢€¤€ €¡€¡€0€0€ €¡€W¢€\0€ € ¡€ B 3¢€¤€ €¡€¡€0€0€ €¡€?¢€D0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€helix 2¢€¤€ €¡€¡€0€0€ €¡€H¢€O0€ €¡€helix 3¢€¤€ €¡€¡€0€0€ €¡€j¢€w0€ €¡€strand 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€strand 2¢€¤€ €¡€¡€0€0€ €¡€¢€$0€ €¡€strand 3¢€¤€ €¡€¡€0€0€ €¡€(¢€-0€ €¡€strand 4¢€¤€ €¡€¡€0€0€ €¡€8¢€<0€ €¡€strand 5¢€¤€ €¡€¡€0€0€ €¡€>¢€E0€ € ¡€strand 6¢€¤€ €¡€¡€0€0€ €¡€V¢€]0€ € ¡€strand 7¢€¤€ €¡€¡€0€0€ €¡€b¢€g¤€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry 1MAI with a vector model attached¡€Resolution: 1.9¢€X-Ray Diffraction£€NOV 8 96 Initial Entry£€0€ € ¡€ ¤€0€0€ €¢€ € €0€ €_¡€0€ €_¡€0€      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnop¢€0€                                                 !!!!!!!!!!!!"""""""""########$$$$$$$$$%%%%%%%%%&&&&&&&&''''''((((((((()))))))********++++++++++++++,,,,,,,,,---------......///////////00000000011111112222222233333333333444444555555566666666677777788888888899999999:::::::::::;;;;;;<<<<<<<<=========>>>>>>>>????????@@@@@@@@@AAAAAAAAABBBBBBBCCCCCCCCCCCDDDDDDDDEEEEFFFFFFFFFFGGGGGGGGGGGHHHHHHHIIIIIIIIIJJJJKKKKKKKKLLLLLLLLLMMMMMMMMMNNNNNNNNNNNOOOOOPPPPPPPPPPPQQQQQQQQRRRRRRRRSSSSSSSTTTTTTTTTUUUUUUUUVVVVVVVVVVVWWWWWWXXXXXXXXXXXYYYYYYZZZZZZZZ[[[[[[[\\\\\\\\\\\]]]]]]]]]^^^^^^^^_________```````````aaaaaaaabbbbbbbccccccccddddddddeeeeeeeeffffffffggggghhhhhhhiiiiiijjjjjjjkkkkkllllllllmmmmmnnnnnnnnnooooooooooppppppppppppppqqqqqqqrrrrrrrrrssssttttttttuuuuuuuuuuuvvvvvvvvvwwwwwwwwxxxxxxxxyyyyyyyyyyy£€0€                                                                                                                                                                                                                                                                                       ¢€0€ €è¡€0€;èI‹#s%p!L (Ó+Å/õ.8ª•µÒ4ã¡# ™¹)K ¸ | Á ¸Ö@˜UãŽ`..t¯Kã|$V"h&_)<$8 Š€Â&*.),š*T,Ä,á2N$"•$å&ȉ‰Ç$¸&Ñ,Å.î%=/i5%7 ;)715§9‚5„45r5g8(1á2x.ƒ7ï2D26Ÿ8_,å(Q#v¤8v<Í:æ6‡>.<åAF;‡7µ@sD{D­@ÓBÎB‹GâHFL II~MýP·JªFÂH¨AmNªRêV¤TùPãM¯KiQ [›_uaûcÉcg/l„l‘qôbdAiÓjµ`ÏcI[Ym‰su,x©v…u‘vt{ò|óstÆpZkûyÏxÍqrm•lZgÞo¶qpqpnúk™u(y|qÚq5l)kÕuôwf{}t¿{ŠwspZuånÖq›h?c+aœ_”_DYÇV!WÈUPV¾b”aœ^]¿fÖjBobrŠwyy¼[`W©Za^(T‹O¾MDPH¦XDZqUËR&^ cGfÀlm”jr‹UÈQ–SWdPÍLdGFM[C)I5DODOñK£G@OSþX©S´\éWè\z`›LÉHÚIÝN HÎEEBBEüFXE×BqAìA¦F|<»IQIdEZCíNçRêR3RïP©C?›@Î=5>œ=Y8K4Ó7ÁEÊGMFG†LøPÙOyUpDîDH÷H£?d9HMvRnV4Y“U(RfUÅVRQtUÔYiV¢R]£[P_åYhWs[V`WR·UïRŒYh\Á\ÁX­Z’^b-]àd‡aøZ¦bæ[Œ_§aBaœd»hÈd4ibköjpRb·eVjYj¨aìdza7\­c6nHs1u†ttvÏ{ÙxŸ{KƒÌxçsÀtoŸlþnÉh‚ÓˆF‹áŠr‰ ‡ˆÒ‡N”…”Š•k•™Îž,™7–S—Y’“|œ\Ÿg¢žIމ‰Y‹é„n‚l~g€Ë{ôæ†!…†€R~H‰ìŠ~%y'x×tëxÖ{â|è|ª}zè€Û€ù{¡y6yé˜Ùzqy/„‚÷wqîmhùplt-rŽtàn‘o#kimarkdhâc/kïiÇkIg5bÀlKg†dNfo`b6_hæekbVdKh{eC]‰Z\¤[ÐT¹QÚQ¢Py_Àbf¢h©eVaádøg.eg÷kÙiVkýoOt vBu—d?az`F]à\S][YµXraË`ä[‰Xéd®j&l j·p©ZUSöWfUBXßYT÷]ŠOMKJ‰GIYGqKçL^J)F¬GðN•RÕVá[_y`[cBk>Ð?Ñ@º924Ú2Î5¾?Ì@©FWI¸GlL¿O~PHLªIñD–KÑCIG—QSvY2[PP¡JØI×DMB%E = [¸aLc¬`âbl_hahÊkrjÛiŽq>r’o«pËl;kžk$e·ea¼\j[X*X¹T÷W0S6]F\S^Ò\®^?Zä]‹b\ZÅc>fd–c÷kânrtev—v–d=c8]±\ùf®lTo nõt@t*vÐYÕT{PpKþRìQùNŠI¥E`QkUÐSâO0OSkJ•J[F(BO=ýHwK™O-JtCÓ@e=F?XC†FÔ?ÛC­814«6D8§/l/Ì5:4´5Ï3Ä6?3>56:´<÷<Ç/D,ý.ú- &ø$¦'xÚ2¸4Þ:Ž<Ü3þ.|.T/ú3Ô6•4Ü<ÞBOC:@?F DÑG*HdN PDE&BÌGöC>HlFPUnU÷S.XçXiY•ZÈ`,cõ[ UÑ\TU½`sebgzdˆd‰i¶blƒnñrAsýr*nþk×nþh´kßh½rëuô{Ì~ºtœnômâh+fË}~ƒ„ú‚®„T<~Y«‰$‹Tˆ$‰Q’é\—ø„.€À~]|U|‹xüupw9xgxyç~ý|âwt¤~©„‡Ÿ„¨tºolüoƒmço˜hh«faÙ^McRf´cOi‹bJ^„[S]gaUd8bh¦VJRùNKQiUÚSôX"LÑH/DZEÁIšMDœOž?§;ž8X7186Ö3©.T+ö3(4.8o,‚''x*»"ë"#Î#]!í#UÕ ‹õ–"ª#b&@+:.‹0f.W+°*;*ð/M2b/ü2É2¬*Ä'Ï)&*t!Ú/ŽI!S(å* /„04)A#Ð"À"§_3h8Â9À;½<Ž=A:™@’<?¨D2B6F¿E¹828þ68‹7-7R:“0ô-º/B/†'û%%)X!0D1µ6Ê7:Ð?ß?ŒA½D/EUIèFl<°<9‘; 8î< 8Ú;è9ã4Ê<ö5ò3Z7;7.û*&˜#! ”:º>—CE#A <äCÛ9/D¯HàG!J]JUL—NUM¢B ?Ñ<#7 <Ï?Ÿ=§DJ@þE=ƃÀ…¾°€p~r‚‰‡uŠwƒ°|±}©€ÅˆÃ¹‰$„~°€“yxÜyõt6yÓsÄ>‰qjù%ætQ nˆo8|i¢X%`èLìu<LÜ3+TlT–‰lŠ—‘›lª|s~€uó…WwG*Å_, E:nÛ1@¾,PssHs6ÂnÝHrQ¨pÔUïbÝ6Yt)L(734DWnBžCçjÀɘYYNŠ´=Ö0º0ŠgwJ ;$zO>nr$†ÞZ䇿då*Ç]vM„jÃFqIÑV±–t3:Øtbx.mÉ}M¦‘Ö;‡…€%Zƒ;ú“ÔDŒE{/’>}=U‡…z&ýnB¢€0€ø—üÇûøùþ‰þ7þo{ùSø¾üåóQú ùžü®þ‹óÙòñÚôkîÒýú•¹ýøÓöš÷¼ç 1ž± )@S0ÌmN‚okþ4›Š#G&Ô"¸nvâÄ ­ •ŒÐÒâ† Æ …»h¥á|:!=©$ö!"ŒÚ P Í zÅn’°—FÄwð›xð†"ò#•&Ú,Y/@-á/>, 3T6Ë;=Þ9=5q3l/³5Ø;?“CAò=96Ó;›GdJüJ¥K,PœQáWVQI¤IbNËPùE5D/BGXH)D+0`1@&Ù'±"ë€tµ49M9R6¨<ó?=ÁB9<ž=X?%B8A_?CB“<º>BA9>5M0Ý8F«JêJ£K6P"P¦NõR½I©HÛL;M‡C >ö9•>MŽP¤M1KU{Y0X,]_LqIDL†QF÷JHMLO R»IšDUE@LŠMþL,IK“FHN/L¬FïD’P3U RÎD¾?5<8c=±=:à; 7 <î;Ü7R?š?Ó@w=+:ˆF==: 4:1©:ê7É9O6·=2,,¨++'C+;,0.;+.Ô->.=- -Q)›0„.¸0q*‹-Œ)æ'?&#p"ê1›2*-ç*¼7€7Ô;¨-¹)Ê$> î*™/<.‡/ž,¨#B ·kïjÀ!Ï!Õ%fP ê ‰] %*#.°3{8+8°<]x‡ ˆƒy…D•5  1#  …óûç¸Å|k^?s t ̹Øs ð~“FxHHG:Ae?–@£GE²HÑ@b9ð>øLœKãP*Mq=²9™Aò;å6Ø1z97ÄAÛÍ,&H›J}6.PU¯!v0¢õ h:@ßJçïÈ4%`94ú1=¬3!ÈCÊ Â3ò@ÿ H-N„1PÿVåRT‰tDGª&×3/TzŽFž8 v;hŠüSôÝ4Ä!¿fM=$úX%‡üDëy>JY¬J©X~áXÉðdK#õ®Td›)JZò{$L9a³2XûEa2wÁ…’X*ãÆ?l#õŽ^›íÄ(·>ÝêA©YUf¯3"y+@g,ýs2övJïèý{ù¦X!£€0€DòCM=:ê;Õ6q2-/¶5¸0‹0@01S-c.í+Œ,n&´$Ï' ¬45Ó7h7ý:S8l4*;.8 9œ4Ï1°<á?Å=8D¦4I/Ô/'*½0Ü6¹8 33V1-}8È;p8ß@+31)+‡(“4Â:/=99À*$¢! ¿#å%ü%¥&$ì"ʱ3ô"#†#— –),-?1Á*îö±Ú°Ì##‚#ñ+ £7© µ ÙÂ)›d›[b')†{ . .[8ûgþÅû²Ès«s”!ºJ8)ÃG·ç® Ú±Ò05± UÄô!ù#;%g)h'n) %L"¼$p%Q(t ¡ Y%ˆ'®,{"†#5! H ?× T?ŽÍ#ĺ<] > zþ kñ¸Á# Ï— &g[ äס®X ¡ Øk> tC˜ Õ Q /uƒ:™*þáþÂ#ûËøûV 3 J o8 „ êzE4 $ í|¾í9j2ŽY„÷‰qû’U´~ +í>h' MŸæ  ß r$€!Â_(m,Õ050 #% Ý#–(!Jè.F Ì"«'ü*ü «).2À7C-Í,¢,µ+¦15j8º= 8ì6°6—9P6Ï9~9¨= =™8v711¬/+—*=+ &ú.±*Y'"#y*.<&i1êÁ>mÓU˜% Ð µ6 "xDVk^ëU í"ÿ"ª@ t öD\þ‹úÇ­©mÿ\ | 5•ÿhýùýIú§õyòòóÄ÷ñ0q(ðÿ =ñÁÇžýÛýÜùËÿû“þ||¼ ÇTµÿüÑ€ì¾$Tÿüãúdõ¡òÍó¹¹) q ù "|‹ n\©¼yèâ‰@ÈØ"t!?%ΈîÊ ]<Æ,w üiÒ™Ü x%Ù&¦ Ký0)e.»2/0Œ/Ù/î4Q+Â4‰+ò0\6­:1=¼?¨=A‡>ÈBQG¾KBc=MG(<ºH}MbNyRÏMaNäP”T÷M’J†K5LiL’F`GXK°CÚMONiT-V©KcELrBDV'[•\C`.]4^a™eá_¿X¢XöSÈPy]@[Ú_ïa¯a?S,NŠPÐTKkF‘IÒOaQ8MH|RwUåW;ZV[Yî^NNÉKRL PgLÝI½C~?yGÉHGÀFÇH‘HMMP©G;B@A°=¸= :ŽNQS3RØVWU¡VvZ ZÜXŠUÆXþN¥N L JJ,ELvL¶JïEC>LZPùPÎMCT0B=<ž:â7"=¥<>>7;>Y:–5*=BªDþAÉAfJ¨N8STSÝVÐ?X.?öA»AûCK+ª'é'à%ä"v °#‰k*&*+/&3V)~$…)Y.»366ÿ5‡0®+š)Ñ;Ü@>Ô@+EJK˜IOV3;(@W6fJdMGMûOUR©UµQñLùMYRMU HjC|B@Z=—;Ú:|S€XW(ZÉYqZý\–^` R_Q$N™OTMËHÂGwFK…ID¹BþG3C F›HG{Bö>¿@ DX=À98+3í4p90E;V{zlÝ#‘%0ÛG&·,<,å0Ê.?+ %Ÿ)7)~)?,?$û%Ò%K*,,  ±”Ž˜,@15X8M2š5…9Z8ã<Ã8—‚Z€<d4˜4ô-TG Ê-_¬û0@& y\YÍ:ŒFU7& <úSZ£€ €0€ €è¡€0€Q¾TÞQýŽí|¿÷ íû]óGâ âS~/&'‚&KÊź¢›Ø"ð¾þ¹ü‹¦sðg¢bG€Ê“›F¢DW»M€K½R0M:YœQ­H6°=+>ä6ì9v@UKú?û?IyRl>ÚG…;t@8LMÅI>=ý_(~|žÊ©.•j?û@UC€@’>KPFÛH/?¢5Ý:˜4N0ŽCO’M»TÄAŸGÕFÛ6ÄHÙUNO$V{uk7±v¿ßPÈA<I¢I¬EÎI)=h?z0¶X>CCGôM:\äKwY_d~JcÍD8!AKÇ8A ;:BÌ<=q?˜8ÁKªT}@ˆ;LÚ7æ7mDç\€Z_•EjFNŽKwQ[JTö^~bÀdw`^n©”y¦5­¿¦é­bGfur`k”RãV+]G[ý]À|°Œ½–Û™‘ œ®‘ð:§/¨û½¯ª´Û·®B¢Ÿ×ž›wž«¥³®œ½ÄSÅÚÃŒŸÄ¡Ë©¯¨ò­¶·É·À¼¹w¾ÈÂ’ÅÀk°ËªúšU™û¾ÜáŸî>íäæ ‹Ã‚xO|‹t„Dk0b)ZmV!k:gÉeþs<RQTëXŽ`óU‹avWwÿO¯OÄS*R÷LqL·IüM”?>G+9&NÞM&N¿P<ZYbpM€U´`5P•gypãt¤y,bl=\§[!€—¬vÉhÝÂשNÞGA=@Mž]zm¥S*8qD\BIGË?˜KA DÀC9D=FdU‹A©K–?ûKm9ÐJVI˜DÀ:\Ðu±Œ½˜žB7æ=J8B,>%0GFNeMžI¬T7^.fN|ŒZ“»˜aQNµP¾WÙ]*uNgHF'EÄ@_HHîQIUP\WbGZÜ`"[gaC^jRv\:^‘_xcát{„D— ¸U»k¶È‚[ôV^‘S¶QSi–Fxeôs1jIi‹öÂߘæ©ìJ^]>`SeßYâ] jóeqRíRvI P pCxt+zWqò”«]¶¬vsv¢y|œ‡c¨=ÉÕßê7pviðhh¹mˆlÔmõbyjÁl h¹drrœjÁfž‚x˜a”¬ <³Ñ-ñ6ë (ó&}‡ y,}Š|j{ç€Q|tw8s´wswd oßlGv„{=}‚z“pl~w.uîw~pÏsÇyr–O—¡|š#k0jÖ[Savq¢}E€ÞŒcOiT`[eÕQS_2r‘{«{«z’ÖXRVLË=ý_¾w¹Dç:*5ƒ6`3r0è7æ;;á9ã. :ò@ˆ8I?„FnK2(5Ê2m7Z4W1)à$,ì1›,ö3…: :H8ó'-0ñ/Ú1."B0\2ª2(;3é2 8!:ò:@./u>øD Uú[ý%Aï4ž2‹72?e0 %Ù.(Y3]=ÕEKª9ø<Œ@i8T?ûG®]Ža3TfŠi<nÒ{¡[_ù`®o®o|f”lpqÝndhˆa&_‹aZYg¬h’YSGMÅP<HÅH‰LêDñB·Uåw~|×—!Hø>b@886Jö>%B: AÈ?Ô?*Q|jILÖ;ö9k8|9“F•IèPOLJOÎQ]689í<;$6}M0FxM±UåL@Q¸EAJN Bh@œEFHl5>GËIB6;jBÂP ^k€`…y·@Î@œDC9í;B@K?e>=!>Š1°D¡N>O$S NQYTº^‘s1n•jýOØWÅcœjS]¡uuw.jSˆqzízM‚³{Ê~£…µÂ‰NŸˆ³_»:˜»£û¦^´ŒÇìÔ²Ù÷ænßGî˜éŽðŸñJ÷»Û¥q¬h¹d´f¨bGeTz0f²mØg„e!b¢~·†`ˆ£blÀs€kM[†N¡DEÄXÞ=ý=ý=šJ’:[b\Nûƒ?jIyóL­c}r}?gymˆ–¾yÌg˜~}ÑÙWYìˆôªÈzW(à°¤›´ZæguÚ‘¾\îË“§»%oIq3pvô¦Ã2‹7ËÔ²ÉIêµS Ÿâ”pÎJ–Û¸Þ“ÅøæO㻫@ªÑëªÛ#Ðü¡æ´½²Þ÷Ϻé£p«h•‰a¬kßG½ˆ ´Œ¾ùõïÆz—àÌt¡ê ʉïëÇß* Z m©`ÊW♀eñêÇ#'‚óõOÖ죄C3ç@ TÒÒ0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€¢€0€ €0€ €B@¡€Ø´¢€OͰ£€R è¡€0€ €B@¡€iAP¢€Vù £€ÎTP¢€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€£€0€ €0€ €B@¡€ðÔÍ¢€’Ï£€"Žh¡€0€ €B@¡€Û)颀ˆê¡£€5èÕ¢€0€ €B@¡€ðó&¢€en£€"ÆJ£€0€ €B@¡€ÛHB¢€ˆ½@£€6 ·¤€0€ €B@¡€ƪý¢€’+¯£€eø¥€0€ €B@¡€±¢€›ƒ£€ Àe¦€0€ €B@¡€ÆÉV¢€‘þN£€Ú§€0€ €B@¡€±r¢€›V £€ øG0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€$¡€£€0€ €0€ €B@¡€œA~¢€¸¹‡£€/Ë[¡€0€ €B@¡€²T—¢€­ð £€±N¢€0€ €B@¡€œpØ¢€¸²Æ£€0 !£€0€ €B@¡€²ƒñ¢€­éH£€ï¤€0€ €B@¡€En¢€ ì_£€uôK¥€0€ €B@¡€X‡¢€ÿ"⣀cÚ>¦€0€ €B@¡€tÈ¢€ 垣€v2§€0€ €B@¡€‡á¢€ÿ!£€d0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€(¢€-¡€£€0€ €0€ €B@¡€9 l¢€êˈ£€×5¡€0€ €B@¡€Vf¸¢€蟡£€ß墀0€ €B@¡€9÷¢€ê“ £€ÖѪ£€0€ €B@¡€VqC¢€èg¹£€ÞÞZ¤€0€ €B@¡€vft¢€žL§£€'°}¥€0€ €B@¡€“ÁÀ¢€œ À£€/½-¦€0€ €B@¡€vpÿ¢€ž¿£€'zò§€0€ €B@¡€“ÌK¢€›èØ£€/‡¢0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€8¢€<¡€£€0€ €0€ €B@¡€Ì®X¢€<íS£€Y󼡀0€ €B@¡€³¤¢€IæJ£€O¶^¢€0€ €B@¡€Ì’Ë¢€<§£€Yß±£€0€ €B@¡€²ë¢€IŸü£€O¢S¤€0€ €B@¡€{¸¢€)˜£€ ê ¥€0€ €B@¡€al¢€6‘£€¬®¦€0€ €B@¡€zø+¢€)QÍ£€ Ö§€0€ €B@¡€aPw¢€6JÄ£€˜£0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€>¢€E¡€£€0€ €0€ €B@¡€œ=¢€JgA£€<Ÿ=¡€0€ €B@¡€šÊÅ¢€Mû|£€Z懢€0€ €B@¡€œ[Ê¢€J“3£€<œØ£€0€ €B@¡€› R¢€N'n£€Zä"¤€0€ €B@¡€ê~}¢€M1A£€R¥€0€ €B@¡€é.¢€PÅ|£€4™×¦€0€ €B@¡€ê¿ ¢€M]3£€P(§€0€ €B@¡€én’¢€Pñn£€4—r0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€H¢€O¡€¢€0€ €0€ €B@¡€aý¢€Åþ¨£€Æa(¡€0€ €B@¡€›Éø¢€_Þ £€ P˜¢€0€ €¡€0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€V¢€]¡€£€0€ €0€ €B@¡€Êë[¢€R½ž£€ÄHÑ¡€0€ €B@¡€ß΢€^†£€±i‚¢€0€ €B@¡€ÊûN¢€RõN£€Ä}=£€0€ €B@¡€ßÞt¢€^¾1£€±î¤€0€ €B@¡€É%c¢€~6£€XÛù¥€0€ €B@¡€Þ‰¢€‰Ý£€Eüª¦€0€ €B@¡€É5V¢€~K检Ye§€0€ €B@¡€Þ|¢€ŠÉ£€F10€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€b¢€g¡€£€0€ €0€ €B@¡€´Êö&Ý£€úWj¡€0€ €B@¡€Ã`¤¢€ùÏ£€ßÉ¢€0€ €B@¡€´¾»¢€õÛœ£€úFZ£€0€ €B@¡€ÃTp¢€ùƒÂ£€ß·õ¤€0€ €B@¡€æ ?¢€/¡µ£€´r¥€0€ €B@¡€ôžô¢€3IÛ£€v& ¦€0€ €B@¡€åý ¢€/Vt£€£b§€0€ €B@¡€ô’À¢€2þš£€vý0€ € ¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€j¢€w¡€¢€0€ €0€ €B@¡€ò´Ð¢€FWУ€GH¡€0€ €B@¡€Ž¢€Å`£€‘¼˜¢€0€ €¡€¡€1€ €0€ €1€®€0€ €1MAI¢€¡€0€ €Ì¡€¢€«€§½¡€1€´€0€ €¡€0€ €Ì¡€¢€¡€Signal Transduction Protein¢€0€mStructure Of The Pleckstrin Homology Domain From Phospholipase C Delta In Complex With Inositol Trisphosphate£€0€}Mol_id: 1; Organism_scientific: Rattus Norvegicus; Organism_common: Rat; Plasmid: Pet11a; Expression_system: Escherichia Coli¤€X-Ray Diffraction¦€(Revision History:~NOV 8 96 Initial Entry«€0€ €1€¡€0€ €0€ € €0€0€ €¡€0€ €Ferguson£€ K.M.Ferguson¤€K.M.0€ €¡€0€ €Lemmon£€ M.A.Lemmon¤€M.A.0€ €¡€0€ € Schlessinger£€J.Schlessinger¤€J.0€ €¡€0€ €Sigler£€ P.B.Sigler¤€P.B.¡€0€ €¡€0€ €Ì¡€¢€«€0€ €1€£€º{N¤€0€ €1€ €sStructure of the high affinity complex of inositol trisphosphate with a phospholipase C pleckstrin homology domain.¡€0€ € €0€0€ €¡€0€ €Ferguson¤€K.M.0€ €¡€0€ €Lemmon¤€M.A.0€ €¡€0€ € Schlessinger¤€J.0€ €¡€0€ €Sigler¤€P.B.¡€ €LDepartment of Chemistry, Yale University, New Haven, Connecticut 06510, USA.¢€ €0€ €1€¤€Cell¥€Cell§€ 0092-8674£€CQ4¡€0€ €¡€0€ €Ë¡€ ¢€¡€83¢€6£€ 1037-1046¶€0€¢€0€ €Rattus norvegicus¡€ Norway rat£€1€0€ €taxon¡€ €'„¥€0€ € €0€ €Rattus¡€ norvegicus£€‰Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Rattus¤€¥€¦€ROD§€¡€0€ €ƒ¡€0€12131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121122123124125126127128129130µ€ (I3P, 200 )¢€0€ € ¡€ ¢€ƒ¦€§€AƒMHGLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVQGLRKIIHHSGSMDQRQK£€1€0€¤€ €1€0€¡€°€ ¤€helix 1¦€£€0€ €¡€£€«€§½0€¡€°€ ¤€helix 2¦€£€0€ €G¡€N£€«€§½0€¡€°€ ¤€helix 3¦€£€0€ €i¡€v£€«€§½0€¡€°€ ¤€strand 1¦€£€0€ €¡€£€«€§½0€¡€°€ ¤€strand 2¦€£€0€ €¡€#£€«€§½0€¡€°€ ¤€strand 3¦€£€0€ €'¡€,£€«€§½0€¡€°€ ¤€strand 4¦€£€0€ €7¡€;£€«€§½0€¡€°€ ¤€strand 5¦€£€0€ €=¡€D£€«€§½0€¡€°€ ¤€strand 6¦€£€0€ €U¡€\£€«€§½0€¡€°€ ¤€strand 7¦€£€0€ €a¡€f£€«€§½